PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G35000.1
Common NameLOC102710092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 802aa    MW: 86065.2 Da    PI: 5.492
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G35000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.3e-2197152156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   +++ +++t++q++eLe+lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
  OB02G35000.1  97 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMK 152
                   678899***********************************************999 PP

2START190.39.7e-603125441206
                   HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S....EEEE CS
         START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla....kaet 81 
                   ela +a++elvk+a+ ++p+Wv         e +n +e+l +f +  +     + +ea+r+sg+v+ +    lve+l+d + +W+ ++     ka++
  OB02G35000.1 312 ELAISAMDELVKMAQMDDPLWVPALpgspskEVLNFEEYLHSFLPCIGmkpagYVSEASRESGLVIIDNSlALVETLMDER-RWSDMFScmiaKATV 407
                   57889*****************99978888888888888888888877*****************9876658999999999.*************** PP

                   EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEE CS
         START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgiliepksnghskvtw 166
                   le +s+g      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    + + v++++lpSg+++++++ng++kvtw
  OB02G35000.1 408 LEEVSTGiagsrnGALLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDHNSAtapTTGNVKCRRLPSGCVMQDTPNGYCKVTW 504
                   ********************************************************965456666567799************************** PP

                   EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                   veh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  OB02G35000.1 505 VEHTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCEC 544
                   **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2281148IPR009057Homeodomain-like
SuperFamilySSF466893.43E-2185154IPR009057Homeodomain-like
PROSITE profilePS5007118.12394154IPR001356Homeobox domain
SMARTSM003891.5E-1995158IPR001356Homeobox domain
CDDcd000865.33E-1996154No hitNo description
PfamPF000469.5E-1997152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PROSITE profilePS5084845.529303547IPR002913START domain
SuperFamilySSF559611.76E-32306544No hitNo description
CDDcd088752.00E-115307543No hitNo description
SMARTSM002346.4E-48312544IPR002913START domain
PfamPF018524.2E-52313544IPR002913START domain
SuperFamilySSF559613.3E-21565768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MSFGGLFDGG GGGSMQFPFA SGFSSSPALS LALDNAGGGI GGRMLAGGAG SSAGGAVTRD  60
TEAENDSRSG SDHLDAISAA GEDDVDDGEP SNPRKRKKRY HRHTPQQIQE LEALFKECPH  120
PDEKQRAELS RRLSLDARQV KFWFQNRRTQ MKTQLERHEN ALLKQENDKL RAENMTIREA  180
MRSPMCGSCG SPAMLGEVSL EEQHLRIENA RLKDELNRVC ALATKFLGKP ISLLSPPPLL  240
QPHLSLPMPN SSLELAIGGI GGLGSLGTLP GCMNEFAGGV SSPMGTVITP ARTTGSALPS  300
LMGNIDRSVF LELAISAMDE LVKMAQMDDP LWVPALPGSP SKEVLNFEEY LHSFLPCIGM  360
KPAGYVSEAS RESGLVIIDN SLALVETLMD ERRWSDMFSC MIAKATVLEE VSTGIAGSRN  420
GALLLMKAEL QVLSPLVPIR EVTFLRFCKQ LAEGAWAVVD VSIDGLVRDH NSATAPTTGN  480
VKCRRLPSGC VMQDTPNGYC KVTWVEHTEY DEASVHQLYR PLLRSGLAFG ARRWLATLQR  540
QCECLAILMS STTVAANDST AISQEGKRSM LKLARRMTEN FCAGVSASSA REWSKLDGAT  600
GSIGEDVRVM ARKSVSEPGE PPGVVLSAAT SVWVPVAPEK LFNFLRDEQL RAEWDILSNG  660
GPMQEMTQIA KGQRDGNSVS LLRASAVSAN QSSMLILQET CTDASGSIVV YAPVDIPAMQ  720
LVMNGGDSTY VALLPSGFAI LPDGPRIGAS GYETGGSLLT VAFQILVNNQ PTAKLTVESV  780
ETVNNLISCT IKKIKTALQC DA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19298PRKRKKR
29397RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016480.0AB101648.1 Oryza sativa Japonica Group Roc5 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647677.10.0PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLJ3LFT30.0J3LFT3_ORYBR; Uncharacterized protein
STRINGOB02G35000.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1